|
|
|
||||||||
The following extracts, decontextualised, disordered, are taken from The Internet Text.
Alan Sondheim writes:
Internet Text Description 1995-9
The text consists of hundreds of sections written over a period of five years, a continuous meditation on cyberspace, emphasizing issues of interiority, subjectivity, body, and language. The extended range of topics includes Net applications, as well as occasional reference to the underlying architecture and protocols of telecommunications; this is the materialist "gristle" that can't be discarded in analysis. All of the sections have been presented on the Fiction-of-Philosophy and Cybermind email-lists, which I co-moderate. The subject matter is in the form of "short-waves, long-waves." The former are the individual sections, written in a variety of styles, and referencing a number of writers ranging from Jabes and Blanchot to Acker and Lingis, with Penrose, Kristeva, and Karl Kraus somewhere in the middle. These texts are completely interrelated; on occasion "characters" appear - these are _actants_ possessing philosophical or psychological import. They also create and problematize narrative sub-structures within the work as a whole. (Such are Clara Hielo Internet, Tiffany, Alan, Travis, Honey, Nikuko, and others.) The long-waves are fuzzy topoi of such issues as death, love, virtual embodiment, the "granularity of the real," and physical reality, which criss-cross the texts. The resulting fragments and coagulations owe something to romanticism, deconstruction, linguistics, prehistory, the philosophy of science, and so forth - but more to the function of sites or nodes on the Net itself. The writing encompasses, past and present, but wagers the future as well; hence, the emphasis on extended virtuality. Reading: I advise at least skimming the first Net1.txt, and then consulting the Index - or follow your own path through the maze / theoretical substance.
And also from 1968:
FACE
"this is what I have been given etc"
INSANE
"less than sufficient"
ARE CRUDE
"more than enough"
and also
not enough words to make a
and also
(past itch) (blud) (haurl haurl)
the writing of 'suicide.')
"Johnny, my god, theyve got Johnny!"
these words were said to me by
How do you know?"
"The radio. i heard Rick, said they
shouldn't have."
"Here are twenty pills. take them."
"What for?"
she went running down the
"Suicide, so you wont have to."
haurl thie hame to his black smiddie
"Johnny, my god, theyve got Johnny!"
these words were said to me by
"How do you 'know?"
"The radio. i heard Rick, said they
shouldn't have."
i question please. your use of
apostrophe.
"The radio. i heard Rick, said they
sh'ouldn't have."
"have have have."
"Cant i use them. if god-please, i
would die."
"Here are twenty pills thake them."
run, crawl, crush down thie haurl hame,
and that's all there is to say about
"it."
("it" is not "black smiddie.")
and also
suicide
i give you twenty pills take them
and also
the future as the past a little later
and also
logical conclusions 3 rreversals
the poem into the typewriter
typed returned to its machine
thought of poem as poemtype
returned to its typewriter
the paper allowed to age naturally
the poem evaporated from the page
the page decayed, page as unstable
organic compound
the poem returned temporarily to basic
elements
the poem returned to original state of
undifferentiated matter
humor as unstable ultimate defense
the exact meaning of that
neuter singular of demonstrative pronoun
slasreverr 3
and also
Poetic Version of the Former
(Written in Real Time)
The words are fed into the machine,
The keys are stilled, returning
To rest silently within their
Carriage. The poet falters, his
Fingers no longer clutching dust
He once described as poetry.
The poet is guessed dead, the work
Yellows upon the page, the staple
Rusts. Into the atmosphere, a tragedy
Is written everything in finality
Flies from earth. The future sun now
Could be described, but you who would
Know it all before would not know it
Then, would not be there. The poem,
Entirely unsung, returns to blown
Matter. No one will remember "blown"
Came from a poem. & laughter in the
Stars will not remain even a thing
For magazines.
(all from an,ode, Burning Deck Press, 1968)
Untitled old man stumbles to the window tumbles to the ground stutters a lot you can't understand him his memories are burned to the ground a lot he types a lot he's got no grounds to type pants are stained he's dribbled his coffee grounds putters in the window forgets what he writes writes grounds he forgets fumbles with his fly open doped on computer slacker keyboard grounded to the light socket his lights go out old man ground to a halt er top she's wearing last night's hard nipples' he typed her last words fuck him he's dead she said fuck him fuck him
on his return in the midst of thick text that everyone writes, making barriers, setting traps where i'm coming, arrows and staked pits where i'm crossing the great writing, i keep dreaming, jennifer, who returns from other pages, disks, entries, who leaps across files, directories, machines, as if one always began with jennifer the root, jennifer always ready at the prompt and waiting, or jennifer@jennifer.com and jennifer@jennifer.com , her legs wrap around my throat at night, she's naked, my tongue is swallowed, i inhale her, there's nothing left of me and i want less than that, she's on me, i breath her into me, my lungs are full of blood from her, my eyes are seeing read through her, my eyes are eyes of jennifer, i'm in her cunt, i'm coming into her, coming through, and the dream of men in a forest, my mouth speaking in tones of a woman, my breasts larger and swollen, i feed myself, i'm alway naked, infant, i drool and topple, hollow, where my cock was, i'm in a universe, i am a universe, maybe i can get some sleep tonight , jennifer coughs and spits me out her mouth, what's left, i want less than that, i'm a carpet stain, buried in cloth , today i was walking with azure in a subway tunnel, she said, the ceiling's low, i said, that's the expression, but at least here and now, it's the floor that's high ,
Tale Two [shinto] priests were walking down a steep hill; they met a [budd- hist] monk walking up. "Where are you going?" one of the priests asked. "It is near the end of the world," said the monk, "and I am going to the top of the hill to observe." "Don't you know," said one of the priests, "it is the same everywhere?" "But not to the hill," answered the monk. When I was telling this story, the rabbi [jewish] asked, "But why were there two priests?" "Because, I answered, one of them might have for- gotten the script." The rabbi answered, "But the world is the script." And I replied, "If the world is the script, it is the hill which is writing and the priests who are reading." The rabbi said, "But it is the monk who guides the pen." A [protestant] minister, happening by, gave his ear to the tale. He said, "The hill has given the pen to the tale." I answered, "But it is christ himself who has given the hill, who has as- cended the hill as the holy mount, to preach to one and all." The monk said, "By what authority do you speak? For you seem to be jewish by cul- ture, if not religion, and hardly catholic, to speak of the christ." I answered, "It is my belief that christ is within all of us, that we are all our sons." The monk said, "Thus we repeatedly give birth to ourselves over and over again, generation upon generation," to which one of the priests replied, "Yes, but it is the latter that speaks to the former, since the latter carries the wisdom of the former." The minister said, "It is upon such that the gospel was written." I answered, "It is upon such that everything is written, from the beginning to the end of the word." The rabbi answered, "Thus is the word made world," and the monk said, "And thus the catholic, the word made flesh. For what is the flesh of the word?" One of the priests said, "To be cleansed and purified, for the circumspection of the living." I added, "Thus for the circumspection of the dead," and the monk replied, "From here throughout our ministra- tions." The rabbi said, "For who is to be believed, properly speaking, but the holy script itself?" A nearby jainist answered, "In relation to the fecundity of the earth, to which we should give as little pain as possible." The monk replied, "What is universal has no recourse among the individual." The rabbi agreed, saying, "And who is among the enlight- ened?" I replied, "Those who know the value of this, not that - and that, not this." "Exactly," cried the monk. The minister, perplexed, ended the session by stating that suffering and enlightenment are both in the hands of god, to whom we give thanks. The priests nodded in assent.
Linux Minicom Log: Sloop-Sailing on the Oceans' Wires 990803 19:20:29 CONNECT 57600 Sailing on the Cyberwaves, 12127414588 990803 19:20:55 Hung up on my long-lost softly rolling waves 990803 19:20:55 Gone offshore searching for my soul 990803 19:24:15 CONNECT 57600 Sailing on the Cyberwaves, 12127414588 990803 19:48:24 Gone offshore searching for my soul 990803 21:45:04 CONNECT 57600 Sailing on the Cyberwaves, 12127414588 990803 21:45:24 Hung up on my long-lost softly rolling waves 990803 21:45:24 Gone offshore searching for my soul 990803 21:46:08 CONNECT 57600 Sailing on the Cyberwaves, 12127414588 990803 21:47:19 Hung up on my long-lost softly rolling waves 990803 22:25:01 CONNECT 57600 P2, 3609201 990803 22:26:32 /usr/bin/sz -vv -b zzz a few precious moments of sleep 990803 22:26:33 Sending: zzz a few precious moments of sleep 990803 22:26:37 Bytes Sent: 1408 BPS:398 990803 22:26:37 Sending: all across the deep blue sea 990803 23:01:07 /usr/bin/rz -vv -b -E 990803 23:01:07 Receiving: seas and sea-straits, dolphins, anglers 990803 23:01:10 Bytes received: 5711/ 5711 BPS:3523 990803 23:02:20 /usr/bin/rz -vv -b -E 990803 23:02:21 Receiving: lakes and oceans, skates and manta-ray 990803 23:02:38 Bytes received: 88087/ 88087 BPS:5233 990803 23:02:38 Receiving: seas and rivers, salmon and tunicates 990803 23:02:39 Bytes received: 2789/ 2789 BPS:3399 990803 23:10:55 /usr/bin/rz -vv -b -E 990803 23:10:56 Receiving: oceans and seas, krill and nurturing plankton 990803 23:10:58 Bytes received: 6319/ 6319 BPS:3828 990803 23:17:19 Gone offshore searching for my soul 990803 23:18:42 CONNECT 57600 P2, 3609201 990803 23:19:27 Gone offshore searching for my soul 990803 23:20:30 Gone offshore searching for my soul searching for my soul and deep-sea dreaming searching for my soul and deep-sea dreaming
My adventure, by Travis At your feet all the water of the stream splashes into a 2-inch slit in the rock. Downstream the streambed is bare rock. down rock You don't fit through a two-inch slit! You're at slit in streambed. down slit You don't fit through a two-inch slit! You're at slit in streambed. down slit, damn it down slit You don't fit through a two-inch slit! You're at slit in streambed. I wanna do the slit damn it, down slit! I don't know that word. down slit please please let me in You don't fit through a two-inch slit! You're at slit in streambed. you're so beautiful and wet, please please please let me in. I don't know that word. knock knock knock What? say Hi and Knock Knock Knock Okay, "hi". say I am slit and do so want you to do me! Okay, "i". say "I am slit and do so want you to do me!" Okay, ""i". You're not listening! I don't know that word. say You-make-this-so-hard!! Give me a break!! I don't know that word. say You-make-this-so-hard Give me a break!! say hello Okay, "hello". say let me in Okay, "let". say let^me^in^! Okay, "let^me^in^!". say You^make^this^so^hard^I^am^slit^and^so^want^you^to^do^me^!^!^! Give me a break!! I don't know that word. say do^me^! Okay, "do^me^!". oh please please you're so soft and beautiful and everything to me ,, oh please please let me in, i'll be yours forever, i'll take care of you and please you all the time and you will be my perfect lover ,, just please please please let me in let me in, pout pout, let me in I don't know that word. oh oh oh oh oh ,, oh quit quit Do you really want to quit now? yes You scored 32 out of a possible 350 using 37 turns. You are obviously a rank amateur. Better luck next time. To achieve the next higher rating, you need 4 more points. Darn!
Aid Dangerous Space These words are written in a dangerous space, unhappy, hinged, ready to collapse; these words need protection; they've got to leave here, go elsewhere, come into your space. Safe Space Now these words are emerging in your space; they're different words; they tell the story or narrative of the space; of the Dangerous Space and the Safe Space; they're safe now. Dangerous Space These words disseminate; perhaps your space isn't safe enough; perhaps other spaces are necessary as well; perhaps only a bloom will do. Safe Space Now these words are in your care; now these words are consigned to you; they're in a safe space; they bring the other words into the safe space, the words of the Dangerous Space as well as the words of the Safe space; they're yours now, under your protection. Dangerous Space For a talisman, for a memento, for a serious souvenir. Safe Space For a trinket-hiding-out; these words are safe, they're in your safe space; they're safe. All of them, the Dangerous Space and the Safe Space, all of them are safe.
THE SECRET CODON OF THE COSMOS
This has been discovered by taking all the primes from 999 to 9999 and
finding their REVERSE OCTAL EQUIVALENTS; the upper binary coding is then
stripped. The result is ASTOUNDING: THIS IS UNIVERSAL ORDER, inscribed
through the protocol of lower ASCII:
'h)h3hAhWu u u#u)u7uAuG v v v!v9vCvIvii )
Immediately, the relationship with DNA is evident; I take this to be the
PRIMORDIAL CODON FOR ALL LIFE. Embedded in our TCP/IP Protocol Suite, who
knows what NEW FORM OF INTELLIGENCE may be GENERATED?
One might enter this into the history for example of the T4 BACTERIOPHAGE
as well as the 1988 INTERNET WORM, observing its re/productive processes.
Investigations HAVE PROCEEDED, however; below is part of the SEQUENCE OF
PRIMES from 10000 to 100000 in REVERSE OCTAL EQUIVALENTS. The RICHNESS OF
this text is UNPARALLELED; even though I have INTERMITTENTLY TRUNCATED the
result, our PATTERNING IS CLEAR ENOUGH:
! " $ $ % & ' ' ( 0 0 1 3 3 3 4 5
6 9 9 B C E E E F G H P Q R S U V X Y ` a b c c e e f h i p q r r s s w x
x y ! # $ % % & ' ' ) 1 1 2 2 5 5 6 9 9 A B C D D F H H I I P Q R T W X Y
Y a b c e h h i p q q s t w x x ! " # $ % & & ' ( ( 0 2 4 4 7 7 7 9 @ @ B
C C E E G G H I P Q Q R S T T V W X X ` a a a d d e e g h i p r s t u v x
y y ! " $ $ % & ) ) 0 2 3 3 3 6 8 9 9 A B D E E F F G I Q R S U V W Y a a
b c d f g h i i i p q r r r u u v x x y " $ $ % ( ) 0 2 2 4 4 6 8 8 @ @ A
B C C D D F G P Q S S T T U U V Y Y b b b c c e f h i q q r s t t u u v w
w x ! " # % & & ' ' ( ( ) 1 1 2 3 4 5 6 7 8 9 @ A B C D E F G I I Q R T U
V X X ` ` a b d d d f f g g h r s s s t v v w x y ! " " $ % & ' 0 1 3 3 6
6 6 8 A A B B D E E G H H I Q T U V V W ` ` a c d e e f g i i p r t t u v
x # # ) ) ) 1 2 2 3 4 5 7 8 8 8 9 @ A C D D F G G H H I P Q S U V W W Y Y
` b b e e f h p q r s t t v x y ! ! " " # % % % ( ( 0 0 1 1 2 4 6 7 7 9 @
A B C D E E F H I P Q R S T U X X Y a f g g i p q q s t u w x y y ! ! ! #
# $ & ' ( 0 0 1 3 7 8 8 9 @ A B B B C D D E F F G G H P P S T T U U W X Y
` ` f h h i p q r s u u u w y ! # # $ & & ) 2 2 3 4 4 5 5 6 8 9 9 @ A C D
G G H P P R S T U V Y Y a b c d h i p q q s t t u u w w x ! ! ! ! ! ! ! !
! ! ! ! ! ! ! ! ! ! ! ! !
!!!"!"!$!&!'!1!1!1!2!4!4!7!7!9!9!@!@!A!C!F!H!I!I!I!P!Q!R!R!R!U!V!V!W!X!X!
Y!`!a!a!d!d!f!g!h!p!r!s!s!u!u!v!w!x! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! " " "
" " " " " " " " " " " " " " " " " " " "
"$"%"'"'"'"'"(")"0"4"4"6"6"8"9"9"C"D"D"E"F"H"H"P"S"T"T"T"V"W"W"a"b"c"c"d"
e"f"g"i"i"p"q"r"r"s"t"u"w"x"x" " " " " " " " " " " " " " " # # # # # # # #
# # # # # # # # # # # # # # # #
#"#%#?'#)#)#1#2#2#3#3#5#6#7#A#C#D#E#G#I#P#S#S#T#U#V#V#V#X#Y#`#`#b#b#b#c#
f#f#g#h#h#q#t#t#t#u#v#w#x# # # # # # # # # # # # # # # # # # # # $ $ $ $ $
$ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $
$"$"$$$%$($1$2$3$5$7$7$9$@$A$A$B$C$D$G$H$I$P$Q$R$S$T$W$Y$a$b$c$e$g$g$i$i$
p$s$t$v$v$x$y$ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ % % % % % % % % % % % % % %
% % %
%!%"%#%$%$%&%0%0%0%0%2%3%4%5%6%7%9%@%A%B%C%E%E%F%F%G%R%S%T%W%W%X%X%`%`%`%
b%c%d%e%f%g%g%i%p%s%t%t%u%v%w%y%y% % % % % % % % % % % % % % % % % & & & &
& & & & & & & & & & & & & & &
&"?&$&%&&&&&)&)&0&1&2&3&5&7&8&9&9&@&A&B&C&D&E&G&H&I&P&Q&U&V&W&Y&Y&b&c&d&
f&h&h&h&i&i&p&q&q&r&r&s&s&u&w&x& & & & & & & & & & & & & & & & & & & ' ' '
' ' ' ' ' ' ' ' ' ' ' ' '
'!'#'$'%'%'''('(')'2'3'6'6'@'@'B'C'C'D'E'G'H'P'R'R'S'T'U'X'a'a'c'd'e'g'h'
i'p's's's't't'u'v'w'w'y'y'y' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ( ( ( ( ( (
( ( ( ( ( ( ( ( ( ( (
(!("('('((((()(0(1(4(5(8(9(@(@(A(C(C(D(F(G(I(I(Q(S(T(T(T(U(W(W(W(Y(`(`(a(
b(b(c(d(e(f(f(f(h(i(p(q(r(u(u(u(w(x(y( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ) ) ) )
) ) ) ) ) ) ) ) ) ) ) ) ) ) ) )
)")#)$)%)&)()0)1)2)3)3)4)6)8)8)9)@)A)B)B)C)D)G)H)P)R)S)S)V)V)X)X)Y)a)b)c)d
)f)g)h)q)r)t)u)u)v) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) 0 0 0 0 0 0 0 0 0 0 0 0
0 0 0 0 0 0 0
0!0"0$0%0%0'0)00010102040408090@0B0C0D0F0F0I0I0P0Q0R0S0U0U0W0Y0c0c0d0d0f0g
0h0i0p0p0q0r0u0v0x0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 1 1 1 1 1 1 1 1
1 1 1 1 1 1 1 1 1 1 1
1"1#1#1$1$1%1%1&1'10111212131315181919191F1G1H1H1Q1Q1S1T1T1T1V1W1`1`1b1d1
d1e1f1f1i1r1r1r1r1t1u1v1y1y1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2 2 2
2 2 2 2 2 2 2 2
2!2#2#2%2%2&2)2020222222242526262727282@2A2A2B2D2D2F2G2I2I2P2S2S2S2V2V2V2
W2W2`2`2a2b2c2d2e2h2p2q2q2q2t2w2w2x2y2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2
3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3
3!3$3(3(30313132333434353537393@3@3B3E3F3F3G3H3I3P3R3S3T3V3V3W3X3X3Y3`3a3
a3a3b3b3c3d3g3p3q3r3s3t3u3v3v3w3y3y3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 4 4 4 4
4 4 4 4 4 4 4 4 4
4!4!4!4#4%4%4&4'4(4)404041414345464646484@4B4C4E4F4G4H4H4I4P4Q4Q4S4T4T4X4
X4Y4`4a4c4d4e4f4g4g4i4p4r4r4s4t4u4u4x4 4 4 4 4 4 4 4 4 4 4 4 4 4 4 5 5 5 5
5 5 5 5 5 5 5 5 5 5 5 5 5 5
5"5"5%5%5&5'5)51515252535556595@5@5A5B5C5D5D5I5P5P5R5R5S5S5S5V5W5Y5Y5Y5`5
a5g5r5s5t5u5u5w5y5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 5 6 6 6 6 6 6 6 6 6 6
6 6 6 6 6 6 6
6!6"6$6%6&6'6)6)60616164646768686C6E6E6F6F6G6I6I6R6R6R6T6U6V6W6X6X6Y6`6b6c
6e6g6g6h6i6i6p6q6s6t6v6v6w6x6x6y6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 7 7 7
7 7 7 7 7 7 7 7 7 7 7 7 7 7
[...]
8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 8 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9
9!9"9"9#9#9$9%9)919192949495969798999@9A9C9D9E9F9P9P9Q9R9T9U9V9V9`9a9b9c9e
9f9g9g9p9q9r9s9t9v9v9w9y9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 @ @ @ @ @ @ @
@ @ @ @ @ @ @ @ @ @ @
@!@#@#@%@'@(@(@4@5@5@6@B@B@B@C@E@G@H@H@I@P@Q@R@S@T@U@W@Y@Y@`@b@c@c@i@i@p@s
@u@u@v@w@x@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ A A A A A A A A A A A A A A
A A A A A A
A!A"A"A#A$A%A&A&A(A)A3A5A5A8A8A8A9AAAAAEAFAGAIAPAQAQARATATAWAYAYA`A`AaAbAb
AdAdAeAeAfAhAqArAsAuAvAwAwA A A A A A A A A A A A A A A A A A A A B B B B
B B B B B B B B B B B B B B B
B"B"B#B%B(B(B)B)B0B2B3B4B5B7B7B9B9B@B@BCBCBDBEBEBFBFBGBHBIBIBPBSBUBVBWB
XBaBdBdBdBfBgBhBiBpBpBpBqBrBsBuBvBwBxByByB B B B B B B B B B B B B B B
B C C C C C C C C C C C C C C C C
[...]
bYeYeYfYfYgYiYiYrYrYtYtYuYwYwYyY Y Y Y Y Y Y Y Y Y Y ` ` ` ` ` ` ` ` ` ` `
` ` ` ` ` ` `
`!`"`%`%`'`(`)`1`3`3`4`7`8`9`A`B`D`D`E`I`P`R`R`S`X`````a`b`c`c`d`d`e`f`
h`p`q`r`s`s`u`v`w`w`y` ` ` ` ` ` ` ` ` ` ` ` ` ` a a a a a a a a a a a a a
a a!a#a%a&a(a)a)a3a3a4a5a6a7a8a@a@aAaFaFaGaHaHaIaPaQaTaTaUaUaVaXa`a`abaca
cadaeaeafagahapaqararauauaxa a a a a a a a a a a a a a a b b b b b b b b b
b b b b b b b b b
b!b!b#b'b)b)b0b2b2b4b5b8b@bAbBbFbGbGbHbIbPbPbSbTbVbXbYbYb`babbbcbebebhbhb
pbrbsbubvbwbyb b b b b b b b b b b b b b b b b c c c c c c c c c c c c c
c!c$c$c'c(c)c1c1c3c3c4c5c6c6c8c9c9c@cAcBcCcDcFcGcHcIcIcRcRcScUcWcXcXcYc`
c`cacbcdcdcecfcgchcicpcpcqcrcsctcvcwcycyc c c c c c c c c c c c c c d d d
d d d d d d d d d d d d
[...]
v v
[...]
w!w#w#w$w$w&w&w&w'w)w1w2w3w4w5w5w7w8wAwAwCwDwGwGwHwIwPwQwRwRwTwTwUwVwV
wWwXwYwawawdwdwewhwhwhwiwqwqwrwswtwtwvwwwxw w w w w w w w w w w w w w x x
x x x x x x x x x x x x x x x
x"x$x%x'x(x0x0x1x1x4x6x@xBxCxCxFxGxIxPxQxQxSxTxUxVxWxXxYx`xbxdxdxex
ixpxqxrxsxwxxxxxyx x x x x x x x x x x x x x x y y y y y y y y y y y y y y
y y
y#y$y%y'y'y(y0y0y3y3y4y5y6y7y9y9yAyByByCyEyHyIySyTyUyVyWyXy`y`yaybycycy
eyfyhyiyiyiyuyvywy
y y y y y y y y y y y y y y y y y y y y " # # # % & ' ' 0 1 2 4 4 6 6 8 B
D D G G H I Q S U V Y ` a b b e e f g g h h h q s t t v w w x " # # ( ) )
0 3 4 4 5 7 7 @ @ B C E F Q R S T U U U V a a b c d d f g h p p p r s t v
w y ! ! " # $ & & ' 0 0 3 4 6 7 8 9 B E F F H H I I P R S T V V W Y ` ` a
a e e i r r r r u v x x y y ! " # # $ % & & ' 1 3 4 5 8 8 9 @ A B C C D D
E G I S U V V W Y Y a b c d e f h p q s v w w y ! " " " # & ) 0 1 1 1 4 4
8 9 @ @ B C C D E F F H I P P R S U U X b c d e g i i p q q s s v x y ! "
" # $ $ % 0 1 3 3 6 6 6 8 B B C D E E F H Q R S T W W Y ` a b b c d f f f
p q q s u x y # $ % & & ( ) ) ) 1 4 5 5 5 6 7 8 8 A B D E F F G I P S S S
V W W X b b g h i q q r u v w x ! " " % % % ' ) ) 1 1 2 3 5 8 @ B B C D G
H I Q Q R S T T U U X X X a b b c d d g g h i i p q s t u v y y " # $ % &
( 0 2 3 3 7 9 A B B F G I I Q R T X Y ` d e e f f f h r t t w x y y ! " #
# & ' ) 0 1 2 6 7 8 9 9 A A C D D E I P Q Q R R S V V Y Y Y ` a b c e e f
g h h u u w x y ! " # $ & ' ( 1 5 5 7 7 7 9 @ @ C C F G H I Q R R S T X Y
a a d d e g g i p p t x y " # $ $ ( ) ) 0 0 3 6 6 8 8 9 9 A B C E E F I I
Q R T W W X Y b c c g i q s u u w x ! " # # $ % & ) 1 1 4 5 5 6 6 7 8 8 9
@ A A C E F F H P P U U V V X b b c d d e f g h i i p q r s u v w x y " #
$ % % & ( ( ( 0 1 2 3 7 7 8 @ A B G H H I I I P R U U U V X ` ` b h p p q
s v v x ! " % & ' ) 0 0 2 3 4 4 5 7 9 9 B C C D D F G H R S T T T U V W Y
` a b d e h i r r t w w x x y ! ! # # # % & & ' ( 1 1 2 3 6 8 @ A A B D D
F F G H P R S S T V X Y ` a b b c e p q q r s s t w x y ! " " # % & & ( )
2 2 3 3 5 7 @ C D E E F F G H I Q R U U X X X d f f g i p s s t u v v w x
y y ! # $ ( 0 0 2 6 6 7 7 8 9 B B D E E F P Q R T T U V W W X ` ` a d e g
q r w w x x ! " " % % & ) 1 2 2 2 4 6 7 8 @ A A B D E E G G I P Q S T V W
Y b b c d f f q q q r s s w w " # $ % % ' ( 1 4 4 6 7 9 9 @ @ C C F I R R
R U U V W X ` a b d f f g p p q q r s v v y
BEYOND THIS ARE UNKNOWNS, ENORMOUS SEQUENCES OF THE ORDER OF THE HUMAN!!
FRIEND! FOLLOW THIS EXACTLY TO REPRODUCE LIFE! FRIEND! THUS SHALL WE LIVE
FOREVER, EMBEDDED IN PERFECT CODE! THERE IS NO OTHER MEANING TO THE WORD!!
- JENNIFER
Return to the poetry page.
Return to the front page.
Internet Text at http://www.anu.edu.au/english/internet_txt
Partial at http://lists.village.virginia.edu/~spoons/internet_txt.html
Trace Projects at http://trace.ntu.ac.uk/writers/sondheim/index.htm